PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo3G0011100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GRAS
Protein Properties Length: 672aa    MW: 72387.7 Da    PI: 6.2067
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo3G0011100genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS416.42.5e-1273026582374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                      +lLl+cAeavs+++le+a+++L ++sel++p g++ qR+aayf eA++arl++s+ ++y+ lpp + +    ++ +aa+++f+ +sP++kfsh+
  Spipo3G0011100 302 LTLLLQCAEAVSADNLEEANRMLLEISELSTPFGTSAQRIAAYFSEAMSARLVSSCLGIYAPLPPAAVH---RQKLAAAYQVFNGISPFVKFSHF 393
                     579************************************************************999999...789999***************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                     taNqaI ea+e+eervHiiD+di+qGlQWp L++ LasRp+gpp +R+Tg+g     s ++le+tg+rL++fAe+lg+pfef + va++  +l++
  Spipo3G0011100 394 TANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGPPYVRLTGLGT----SMDALEATGKRLTDFAETLGLPFEFYP-VAEKAGNLDP 483
                     *****************************************************....***************************.7********* PP

            GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                     e+L+v+++Ea+aV++ +  h+l+d ++s ++    +L+l+++l Pkvv++veq+++h ++sFl rf+ea++yysalfdsl a+++++s+er+ vE
  Spipo3G0011100 484 ERLHVSKREAVAVHWLH--HSLYDVTGSDAN----TLWLLQRLAPKVVTMVEQDLSH-AGSFLGRFVEAIHYYSALFDSLGATYAEDSHERHIVE 571
                     *****************..999999999999....**********************.899********************************** PP

            GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     ++ll+rei+nv+a  ga+r+ + + +++Wre+l+++GF+ ++l+  aa qa lll++++sdgy++ ee+g+l lgWkd  L+++SaW+
  Spipo3G0011100 572 QQLLSREIRNVLAVGGAARTGEVK-FQNWREKLSQSGFRGISLGGAAAHQATLLLSMFPSDGYTLVEENGALRLGWKDLCLLTASAWK 658
                     ******************998887.**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.409275638IPR005202Transcription factor GRAS
PfamPF035148.6E-125302658IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 672 aa     Download sequence    Send to blast
VGDLGGPPSL LLPTLNIESS NAGAGPPPLL PSPGGLQRLP PPSAPPPVCG FSGLPLFQSE  60
LDRGDNDGLP LVASSADDGS SSNATSWIDG IIRELITSSS TEVSIPQLIQ NVREVVHPCN  120
PNLAAVLEYR LRSLTSSFAS LADHHQHSLQ LQGTPLTLPA GIAELPVKRS EVRLPQPAAA  180
AVLVQPTSRR SPANQFLNWE ANHTQLHSRV AAPAAPPNNS LPHSSQQQQH RPQQNQQYPT  240
QQPAAPPLLQ QQQEPEQQSS ATTEETTAVA AAAAQAAAAV ATREKKEELR KQKRDEEGLH  300
LLTLLLQCAE AVSADNLEEA NRMLLEISEL STPFGTSAQR IAAYFSEAMS ARLVSSCLGI  360
YAPLPPAAVH RQKLAAAYQV FNGISPFVKF SHFTANQAIQ EAFEREERVH IIDLDIMQGL  420
QWPGLFHILA SRPGGPPYVR LTGLGTSMDA LEATGKRLTD FAETLGLPFE FYPVAEKAGN  480
LDPERLHVSK REAVAVHWLH HSLYDVTGSD ANTLWLLQRL APKVVTMVEQ DLSHAGSFLG  540
RFVEAIHYYS ALFDSLGATY AEDSHERHIV EQQLLSREIR NVLAVGGAAR TGEVKFQNWR  600
EKLSQSGFRG ISLGGAAAHQ ATLLLSMFPS DGYTLVEENG ALRLGWKDLC LLTASAWKPI  660
GGAAAYGAAT R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-523016584375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010278894.10.0PREDICTED: protein SCARECROW
SwissprotQ2Z2E90.0SCR_IPONI; Protein SCARECROW
TrEMBLB9S1W40.0B9S1W4_RICCO; Transcription factor, putative
STRINGVIT_08s0056g00050.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137138122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein